PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00301.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 186aa    MW: 21643.8 Da    PI: 6.0125
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00301.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.37.7e-1472121554
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                              +++rr+ +NRe+ArrsR RK+  ++eL   v+ L +eN++L ++l++ ++
  Rsa1.0_00301.1_g00002.1  72 RKQRRMVSNRESARRSRMRKQRHLDELLSQVAWLRSENQQLLDKLNQASD 121
                              689***************************************99998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.0E-1168132IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.65770118IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1709.3E-1171123No hitNo description
SuperFamilySSF579599.38E-1372122No hitNo description
PfamPF001701.3E-1172122IPR004827Basic-leucine zipper domain
CDDcd147025.43E-1873120No hitNo description
PROSITE patternPS0003607590IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MQPYYDSSSL NNMQQQDYFH LNHYYNNLNS STNTNNLIPY PQIQELNLQS PASNNSTTSD  60
EATEDIFVIN ERKQRRMVSN RESARRSRMR KQRHLDELLS QVAWLRSENQ QLLDKLNQAS  120
DSNNLAIQEN LSLKEENLEL RQVITSMKKL KGSTSIQGRY CSSSVDHELD QDFSCITDDP  180
RICHPS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18491RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00512DAPTransfer from AT5G15830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2400870.0AC240087.1 Brassica oleracea clone BOT01-44D22, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013659921.11e-116PREDICTED: basic leucine zipper 43-like
RefseqXP_013618656.11e-116PREDICTED: basic leucine zipper 43-like
SwissprotQ9FMC22e-31BZP43_ARATH; Basic leucine zipper 43
TrEMBLA0A078DP031e-116A0A078DP03_BRANA; BnaC02g06270D protein
TrEMBLA0A0D3AJ971e-116A0A0D3AJ97_BRAOL; Uncharacterized protein
STRINGBra023540.1-P1e-115(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM106321532
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15830.11e-83basic leucine-zipper 3